Homepage | Set Home | Add to Favorites
Member

Zhongshan Xinhui Precision Technology Co. Ltd


Search
 

Friends links
  • No link

Browse by Showcase | Browse by List Products
Picture Heading Updated
Catfish Food
Model Number: Catfish Food Brand Name: YATAI Key Specifications/Special Features: Fish foodProtein: 30% minMoisture: 8% maxAsh: 12% maxCrude fiber: 12% maxAppearance: brown yellowPacking: 25kg/bag, PP bags with PE linersLoading quantity:1*20''...
2017-11-24
High Quality Floating Fish Feed
Model Number: Floating Fish feed 36% Brand Name: YATAI Key Specifications/Special Features: High Quality Floating Fish FeedSpecifications:Protein: 36% minMoisture: 10% maxAsh: 10% maxFat: 7%-8%Fiber: 4% maxLysine: 1.2% minPhosphorous: 0.8% minMe...
2017-11-03
High Quality Floating Fish Feed Pellet for Catfish
Model Number: animal feed Brand Name: yatai Key Specifications/Special Features: Directions for Use1.Accordingtogrowthcycledeterminefeedingfeedtype,inordertomeetthecatfishdifferentgrowthstagesofnutritionalrequirements.2.Do"timing,point,quantitat...
2017-08-26
   Home   Next   Previous   Last